Canmetcon
Identification
Name:Zinc transporter zupT
Synonyms:Not Available
Gene Name:zupT
Enzyme Class:Not Available
Biological Properties
General Function:Involved in metal ion transmembrane transporter activity
Specific Function:Mediates zinc uptake. May also transport other divalent cations
Cellular Location:Cell membrane; Multi-pass membrane protein (Potential)
SMPDB Pathways:Not Available
KEGG Pathways:Not Available
Transports:
Transport References:
  • Uniprot Consortium (2012). "Reorganizing the protein space at the Universal Protein Resource (UniProt)." Nucleic Acids Res 40:D71-D75. Pubmed: 22102590
Metabolites:
ECMDB IDNameView
ECMDB01303ZincMetaboCard
GO Classification:
Component
cell part
membrane
Function
cation transmembrane transporter activity
ion transmembrane transporter activity
metal ion transmembrane transporter activity
substrate-specific transmembrane transporter activity
transmembrane transporter activity
transporter activity
Process
cation transport
establishment of localization
ion transport
metal ion transport
transmembrane transport
transport
Gene Properties
Blattner:Not Available
Gene OrientationNot Available
Centisome Percentage:Not Available
Left Sequence EndNot Available
Right Sequence EndNot Available
Gene Sequence:
>774 bp
ATGGCTCGTAAATGGTTGAACTTGTTTGCCGGGGCGGCACTCTCTTTCGCTGTTGCTGGC
AATGCACTGGCAGATGAAGGGAAAATCACGGTGTTCGCCGCCGCATCACTGACTAACGCA
ATGCAGGACATTGCTACGCAGTTTAAAAAAGAGAAAGGCGTGGATGTGGTTTCTTCTTTC
GCTTCGTCATCTACTCTCGCCCGTCAGATTGAAGCGGGTGCGCCTGCGGATCTGTTTATT
TCTGCCGATCAGAAATGGATGGATTATGCGGTTGATAAAAAAGCGATCGATACAGCTACG
CGTCAGACACTGCTCGGCAATAGCCTGGTCGTTGTAGCACCGAAAGCCAGCGTGCAGAAA
GATTTCACCATCGACAGCAAAACCAACTGGACTTCACTGCTGAATGGCGGTCGCCTGGCG
GTTGGCGATCCGGAACATGTTCCCGCTGGCATTTATGCAAAAGAAGCACTGCAAAAACTG
GGCGCATGGGATACGCTCTCTCCGAAACTGGCCCCAGCGGAAGATGTTCGTGGGGCGCTG
GCGCTGGTCGAACGTAACGAAGCGCCTCTGGGCATTGTCTACGGTTCTGACGCAGTTGCC
AGCAAAGGGGTAAAAGTGGTTGCCACCTTCCCGGAAGATTCACATAAAAAAGTGGAATAT
CCGGTTGCTGTTGTGGAAGGGCATAACAATGCGACAGTGAAAGCATTTTATGATTATCTG
AAGGGACCGCAGGCAGCGGAAATCTTTAAACGTTACGGATTTACAATCAAGTAA
Protein Properties
Pfam Domain Function:
Protein Residues:257
Protein Molecular Weight:26484
Protein Theoretical pI:7
Signaling Regions:
  • None
Transmembrane Regions:
  • 5-25
  • 32-52
  • 61-81
  • 137-157
  • 171-191
  • 195-215
  • 236-256
Protein Sequence:
>Zinc transporter zupT
MSVPLILTILAGAATFIGAFLGVLGQKPSNRLLAFSLGFAAGIMLLISLMEMLPAALAAE
GMSPVLGYGMFIFGLLGYFGLDRMLPHAHPQDLMQKSVQPLPKSIKRTAILLTLGISLHN
FPEGIATFVTASSNLELGFGIALAVALHNIPEGLAVAGPVYAATGSKRTAILWAGISGLA
EILGGVLAWLILGSMISPVVMAAIMAAVAGIMVALSVDELMPLAKEIDPNNNPSYGVLCG
MSVMGFSLVLLQTAGIG
References
External Links:
ResourceLink
Uniprot ID:C4ZQV8
Uniprot Name:ZUPT_ECOBW
GenBank Gene ID:CP001396
Genebank Protein ID:238861794
CCDB:ZUPT_ECOBW
General Reference:
  • Ferenci, T., Zhou, Z., Betteridge, T., Ren, Y., Liu, Y., Feng, L., Reeves, P. R., Wang, L. (2009). "Genomic sequencing reveals regulatory mutations and recombinational events in the widely used MC4100 lineage of Escherichia coli K-12." J Bacteriol 191:4025-4029. Pubmed: 19376874