Canmetcon
Identification
Name:Putative sialic acid transporter
Synonyms:
  • Sialic acid permease
Gene Name:nanT
Enzyme Class:Not Available
Biological Properties
General Function:Involved in transmembrane transport
Specific Function:May be a sugar-cation symporter involved in sialic acid uptake
Cellular Location:Cell inner membrane; Multi-pass membrane protein
SMPDB Pathways:Not Available
KEGG Pathways:Not Available
Transports:
Transport References:
  • Uniprot Consortium (2012). "Reorganizing the protein space at the Universal Protein Resource (UniProt)." Nucleic Acids Res 40:D71-D75. Pubmed: 22102590
Metabolites:
ECMDB IDNameView
ECMDB00830N-Acetylneuraminic acidMetaboCard
GO Classification:
Component
cell part
integral to membrane
intrinsic to membrane
membrane part
Function
carbohydrate transmembrane transporter activity
substrate-specific transmembrane transporter activity
transmembrane transporter activity
transporter activity
Process
establishment of localization
transmembrane transport
transport
Gene Properties
Blattner:Not Available
Gene OrientationNot Available
Centisome Percentage:Not Available
Left Sequence EndNot Available
Right Sequence EndNot Available
Gene Sequence:
>1491 bp
ATGGTGGCGGTGATTTATGCACCGCTGATCCCGGCAGCTCTCACGCTGATATCGCCTGCT
TTGTCGTTGACACACTGGCAGGCGTTATTTGCCGATCCACAGTTACCGCAGGCATTACTG
GCAACGCTGGTGTCGACAACCATCGCGGCGGTCGGGGCATTGTTGATTGCCCTGCTGGTG
ATTGTGGCGCTGTGGCCTGGGCCGAAATGGCAGCGTATGTGCGCCCGTCTGCCGTGGCTG
CTCGCCATTCCCCATGTGGCTTTTGCCACCAGCGCCCTTCTGCTCTTTGCTGACGGAGGG
CTGCTTTATGACTATTTCCCGTATTTCACTCCGCCAATGGACCGATTTGGCATCGGTCTG
GGCCTCACCCTTGCAGTGAAAGAAAGCGCATTTCTGCTGTGGATCTTAGCAGCAGTATTG
AGCGAAAAATGGCTGTTGCAGCAGGTCATTGTGCTGGATTCGCTGGGCTACAGCCGCTGG
CAATGCCTGAACTGGCTGCTGTTGCCCTCCGTCGCGCCTGCGCTGGCAATGGCGATGCTG
GCGATTGTTGCCTGGTCGCTGTCGGTCGTGGATGTGGCAATTATTCTCGGGCCAGGTAAT
CCCCCGACGCTGGCGGTAATTAGCTGGCAGTGGTTAACCCAGGGCGACATTGACCAACAA
ACAAAAGGCGCGCTTGCCAGCCTGCTGTTGATGCTGTTACTCGCCGCCTACGTTTTGCTG
AGCTATCTGCTATGGCGCAGCTGGCGGCGCACTATTCCCCGCGTAGATGGCGTTCGCAAG
CCTGCCACGCCTTTATTGCCGGGCAATACGCTGGCGATTTTTTTACCCTTAACCGGTGTG
CTGTGTGTGGTTCTGCTGGCGATCCTCGCGGATCAGTCGACGATCAATAGTGAAGCGCTC
ATCAACAGCCTGACAATGGGGCTGGTGGCGACATTCATCGCTTTGCTCCTGTTACTGCTG
TGGCTGGAATGGGGGCCACAGCGTCGCCAGTTGTGGCTATGGTTGCCCATTTTATTACCT
GCTCTGCCACTGGTGGCGGGCCAGTACACGCTGGCGCTATGGCTGAAACTGGATGGAAGC
TGGACGGCGGTGGTCTGGGGGCATCTGCTGTGGGTGATGCCGTGGATGCTGTTTATCCTG
CAACCCGCCTGGCAGCGCATTGATTCACGGTTAATTTTGATTGCGCAAACACTGGGCTGG
TCGCGGGCCAAAATCTTCTTTTACGTGAAATGCCCACTCATGTTGCGCCCTGTGCTGATT
GCCTTCGCGGTGGGATTTGCAGTCGGTATTGCGCAGTATATGCCAACGCTGTGGCTGGGC
GCGGGGCGTTTTCCGACGCTCACCACTGAGGCGGTGGCATTAAGCAGCGGCGGCAGCAAC
GGTATTCTCGCCGCCCAGGCTTTATGGCAACTGCTATTACCGCTTATTATTTTTGCCCTG
ACCGCGTTAGTCGCAAAATGGGTAGGTTATGTCAGACAAGGACTCCGCTAA
Protein Properties
Pfam Domain Function:
Protein Residues:496
Protein Molecular Weight:53551
Protein Theoretical pI:10
Signaling Regions:
  • None
Transmembrane Regions:
  • 22-42
  • 58-78
  • 92-112
  • 116-136
  • 148-168
  • 170-190
  • 224-244
  • 247-267
  • 278-298
  • 313-333
  • 355-375
  • 406-426
  • 431-451
Protein Sequence:
>Putative sialic acid transporter
MSTTTQNIPWYRHLNRAQWRAFSAAWLGYLLDGFDFVLIALVLTEVQGEFGLTTVQAASL
ISAAFISRWFGGLMLGAMGDRYGRRLAMVTSIVLFSAGTLACGFAPGYITMFIARLVIGM
GMAGEYGSSATYVIESWPKHLRNKASGFLISGFSVGAVVAAQVYSLVVPVWGWRALFFIG
ILPIIFALWLRKNIPEAEDWKEKHAGKAPVRTMVDILYRGEHRIANIVMTLAAATALWFC
FAGNLQNAAIVAVLGLLCAAIFISFMVQSAGKRWPTGVMLMVVVLFAFLYSWPIQALLPT
YLKTDLAYNPHTVANVLFFSGFGAAVGCCVGGFLGDWLGTRKAYVCSLLASQLLIIPVFA
IGGANVWVLGLLLFFQQMLGQGIAGILPKLIGGYFDTDQRAAGLGFTYNVGALGGALAPI
IGALIAQRLDLGTALASLSFSLTFVVILLIGLDMPSRVQRWLRPEALRTHDAIDGKPFSG
AVPFGSAKNDLVKTKS
References
External Links:
ResourceLink
Uniprot ID:B1XHJ7
Uniprot Name:NANT_ECODH
GenBank Gene ID:CP000948
Genebank Protein ID:169889247
CCDB:NANT_ECODH
General Reference:
  • Durfee, T., Nelson, R., Baldwin, S., Plunkett, G. 3rd, Burland, V., Mau, B., Petrosino, J. F., Qin, X., Muzny, D. M., Ayele, M., Gibbs, R. A., Csorgo, B., Posfai, G., Weinstock, G. M., Blattner, F. R. (2008). "The complete genome sequence of Escherichia coli DH10B: insights into the biology of a laboratory workhorse." J Bacteriol 190:2597-2606. Pubmed: 18245285