Identification
Name:Threonine/serine transporter tdcC
Synonyms:
  • H(+)/threonine-serine symporter
Gene Name:tdcC
Enzyme Class:Not Available
Biological Properties
General Function:Involved in transporter activity
Specific Function:Involved in the import of threonine and serine into the cell, with the concomitant import of a proton (symport system)
Cellular Location:Cell inner membrane; Multi-pass membrane protein
SMPDB Pathways:
KEGG Pathways:
Transports:
Transport References:
  • Uniprot Consortium (2012). "Reorganizing the protein space at the Universal Protein Resource (UniProt)." Nucleic Acids Res 40:D71-D75. Pubmed: 22102590
SMPDB Reactions:
L-Threonine+Thumb+Thumb+tRNA(Thr)+ThumbPyrophosphate+Thumb+L-Threonyl-tRNA(Thr)
L-Threonine + Adenosine triphosphate + Hydrogen ion + tRNA(Thr) + L-Threonine → Pyrophosphate + Adenosine monophosphate + L-Threonyl-tRNA(Thr)
ReactionCard
Metabolites:
ECMDB IDNameView
ECMDB00045Adenosine monophosphateMetaboCard
ECMDB00538Adenosine triphosphateMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB00187L-SerineMetaboCard
ECMDB00167L-ThreonineMetaboCard
GO Classification:
Component
cell part
integral to membrane
intrinsic to membrane
membrane part
Function
transporter activity
Process
establishment of localization
transport
Gene Properties
Blattner:Not Available
Gene OrientationNot Available
Centisome Percentage:Not Available
Left Sequence EndNot Available
Right Sequence EndNot Available
Gene Sequence:
>1332 bp
ATGCAACCGTCCAGAAACTTTGACGATCTCAAATTCTCCTCTATTCACCGCCGCATTTTG
CTGTGGGGAAGCGGTGGTCCGTTTCTGGATGGTTATGTACTGGTAATGATTGGCGTGGCG
CTGGAGCAACTGACGCCGGCGCTGAAACTGGACGCTGACTGGATTGGCTTGCTGGGCGCG
GGAACGCTCGCCGGGCTGTTCGTTGGCACATCGCTGTTTGGTTATATTTCCGATAAAGTC
GGACGGCGCAAAATGTTCCTCATTGATATCATCGCCATCGGCGTGATATCGGTGGCGACG
ATGTTTGTTTCATCCCCCGTCGAACTGTTGGTGATGCGGGTACTTATCGGCATTGTCATC
GGTGCAGATTATCCCATCGCCACCTCAATGATCACCGAGTTCTCCAGTACCCGTCAGCGG
GCGTTTTCCATCAGCTTTATTGCCGCGATGTGGTATGTCGGCGCGACCTGTGCCGATCTG
GTCGGCTACTGGCTTTATGATGTGGAAGGCGGCTGGCGCTGGATGCTGGGTAGCGCGGCG
ATCCCCTGTTTGTTGATTTTGATTGGTCGATTCGAACTGCCTGAATCTCCCCGCTGGTTA
TTACGCAAAGGGCGAGTAAAAGAGTGCGAAGAGATGATGATCAAACTGTTTGGCGAACCG
GTGGCTTTCGATGAAGAGCAGCCGCAGCAAACCCGTTTTCGCGATCTGTTTAATCGCCGC
CATTTTCCTTTTGTTCTGTTTGTTGCCGCCATCTGGACCTGCCAGGTGATCCCAATGTTC
GCCATTTACACCTTTGGCCCGCAAATCGTTGGTTTGTTGGGATTGGGGGTTGGCAAAAAC
GCGGCACTAGGGAATGTGGTGATTAGCCTGTTCTTTATGCTCGGCTGTATTCCGCCGATG
CTGTGGTTAAACACTGCCGGACGGCGTCCATTGTTGATTGGCAGCTTTGCCATGATGACG
CTGGCGCTGGCGGTTTTGGGGCTAATCCCGGATATGGGGATCTGGCTGGTAGTGATGGCC
TTTGCGGTGTATGCCTTTTTCTCTGGCGGGCCGGGTAATTTGCAGTGGCTCTATCCTAAT
GAACTCTTCCCGACAGATATCCGCGCCTCTGCCGTGGGCGTGATTATGTCCTTAAGTCGT
ATTGGCACCATTGTTTCGACCTGGGCACTACCGATCTTTATCAATAATTACGGTATCAGT
AACACGATGCTAATGGGGGCGGGTATCTCGCTGTTTGGCTTGTTGATTTCCGTAGCGTTT
GCCCCGGAGACTCGAGGGATGTCACTGGCGCAGACCAGCAATATGACGATCCGCGGGCAG
AGAATGGGGTAA
Protein Properties
Pfam Domain Function:
Protein Residues:443
Protein Molecular Weight:48878
Protein Theoretical pI:9
Signaling Regions:
  • None
Transmembrane Regions:
  • 22-42
  • 44-64
  • 97-117
  • 140-160
  • 163-183
  • 207-227
  • 261-281
  • 311-331
  • 366-386
  • 389-409
  • 423-443
Protein Sequence:
>Threonine/serine transporter tdcC
MSTSDSIVSSQTKQSSWRKSDTTWTLGLFGTAIGAGVLFFPIRAGFGGLIPILLMLVLAY
PIAFYCHRALARLCLSGSNPSGNITETVEEHFGKTGGVVITFLYFFAICPLLWIYGVTIT
NTFMTFWENQLGFAPLNRGFVALFLLLLMAFVIWFGKDLMVKVMSYLVWPFIASLVLISL
SLIPYWNSAVIDQVDLGSLSLTGHDGILITVWLGISIMVFSFNFSPIVSSFVVSKREEYE
KDFGRDFTERKCSQIISRASMLMVAVVMFFAFSCLFTLSPANMAEAKAQNIPVLSYLANH
FASMTGTKTTFAITLEYAASIIALVAIFKSFFGHYLGTLEGLNGLVLKFGYKGDKTKVSL
GKLNTISMIFIMGSTWVVAYANPNILDLIEAMGAPIIASLLCLLPMYAIRKAPSLAKYRG
RLDNVFVTVIGLLTILNIVYKLF
References
External Links:
ResourceLink
Uniprot ID:B1XGT1
Uniprot Name:TDCC_ECODH
GenBank Gene ID:CP000948
Genebank Protein ID:169887543
CCDB:TDCC_ECODH
General Reference:
  • Durfee, T., Nelson, R., Baldwin, S., Plunkett, G. 3rd, Burland, V., Mau, B., Petrosino, J. F., Qin, X., Muzny, D. M., Ayele, M., Gibbs, R. A., Csorgo, B., Posfai, G., Weinstock, G. M., Blattner, F. R. (2008). "The complete genome sequence of Escherichia coli DH10B: insights into the biology of a laboratory workhorse." J Bacteriol 190:2597-2606. Pubmed: 18245285