Canmetcon
Identification
Name:Zinc transporter zupT
Synonyms:Not Available
Gene Name:zupT
Enzyme Class:Not Available
Biological Properties
General Function:Involved in metal ion transmembrane transporter activity
Specific Function:Mediates zinc uptake. May also transport other divalent cations
Cellular Location:Cell membrane; Multi-pass membrane protein (Potential)
SMPDB Pathways:Not Available
KEGG Pathways:Not Available
Transports:
Transport References:
  • Uniprot Consortium (2012). "Reorganizing the protein space at the Universal Protein Resource (UniProt)." Nucleic Acids Res 40:D71-D75. Pubmed: 22102590
Metabolites:
ECMDB IDNameView
ECMDB01303ZincMetaboCard
GO Classification:
Component
cell part
membrane
Function
cation transmembrane transporter activity
ion transmembrane transporter activity
metal ion transmembrane transporter activity
substrate-specific transmembrane transporter activity
transmembrane transporter activity
transporter activity
Process
cation transport
establishment of localization
ion transport
metal ion transport
transmembrane transport
transport
Gene Properties
Blattner:Not Available
Gene OrientationNot Available
Centisome Percentage:Not Available
Left Sequence EndNot Available
Right Sequence EndNot Available
Gene Sequence:
>774 bp
ATGGCTCGTAAATGGTTGAACTTGTTTGCCGGGGCGGCACTCTCTTTCGCTGTTGCTGGC
AATGCACTGGCAGATGAAGGGAAAATCACGGTGTTCGCCGCCGCATCACTGACTAACGCA
ATGCAGGACATTGCTACGCAGTTTAAAAAAGAGAAAGGCGTGGATGTGGTTTCTTCTTTC
GCTTCGTCATCTACTCTCGCCCGTCAGATTGAAGCGGGTGCGCCTGCGGATCTGTTTATT
TCTGCCGATCAGAAATGGATGGATTATGCGGTTGATAAAAAAGCGATCGATACAGCTACG
CGTCAGACACTGCTCGGCAATAGCCTGGTCGTTGTAGCACCGAAAGCCAGCGTGCAGAAA
GATTTCACCATCGACAGCAAAACCAACTGGACTTCACTGCTGAATGGCGGTCGCCTGGCG
GTTGGCGATCCGGAACATGTTCCCGCTGGCATTTATGCAAAAGAAGCACTGCAAAAACTG
GGCGCATGGGATACGCTCTCTCCGAAACTGGCCCCAGCGGAAGATGTTCGTGGGGCGCTG
GCGCTGGTCGAACGTAACGAAGCGCCTCTGGGCATTGTCTACGGTTCTGACGCAGTTGCC
AGCAAAGGGGTAAAAGTGGTTGCCACCTTCCCGGAAGATTCACATAAAAAAGTGGAATAT
CCGGTTGCTGTTGTGGAAGGGCATAACAATGCGACAGTGAAAGCATTTTATGATTATCTG
AAGGGACCGCAGGCAGCGGAAATCTTTAAACGTTACGGATTTACAATCAAGTAA
Protein Properties
Pfam Domain Function:
Protein Residues:257
Protein Molecular Weight:26484
Protein Theoretical pI:7
Signaling Regions:
  • None
Transmembrane Regions:
  • 5-25
  • 32-52
  • 61-81
  • 137-157
  • 171-191
  • 195-215
  • 236-256
Protein Sequence:
>Zinc transporter zupT
MSVPLILTILAGAATFIGAFLGVLGQKPSNRLLAFSLGFAAGIMLLISLMEMLPAALAAE
GMSPVLGYGMFIFGLLGYFGLDRMLPHAHPQDLMQKSVQPLPKSIKRTAILLTLGISLHN
FPEGIATFVTASSNLELGFGIALAVALHNIPEGLAVAGPVYAATGSKRTAILWAGISGLA
EILGGVLAWLILGSMISPVVMAAIMAAVAGIMVALSVDELMPLAKEIDPNNNPSYGVLCG
MSVMGFSLVLLQTAGIG
References
External Links:
ResourceLink
Uniprot ID:B1XG45
Uniprot Name:ZUPT_ECODH
GenBank Gene ID:CP000948
Genebank Protein ID:169888257
CCDB:ZUPT_ECODH
General Reference:
  • Durfee, T., Nelson, R., Baldwin, S., Plunkett, G. 3rd, Burland, V., Mau, B., Petrosino, J. F., Qin, X., Muzny, D. M., Ayele, M., Gibbs, R. A., Csorgo, B., Posfai, G., Weinstock, G. M., Blattner, F. R. (2008). "The complete genome sequence of Escherichia coli DH10B: insights into the biology of a laboratory workhorse." J Bacteriol 190:2597-2606. Pubmed: 18245285