Identification
Name:Vitamin B12 import system permease protein BtuC
Synonyms:Not Available
Gene Name:btuC
Enzyme Class:Not Available
Biological Properties
General Function:Involved in cobalamin transport
Specific Function:Part of the ABC transporter complex BtuCDF involved in vitamin B12 import. Involved in the translocation of the substrate across the membrane
Cellular Location:Cell inner membrane; Multi-pass membrane protein
SMPDB Pathways:
  • adenosylcobalamin salvage from cobinamide PW001884
KEGG Pathways:Not Available
Transports:
Transport References:
  • Uniprot Consortium (2012). "Reorganizing the protein space at the Universal Protein Resource (UniProt)." Nucleic Acids Res 40:D71-D75. Pubmed: 22102590
SMPDB Reactions:
Cobinamide+Thumb+Thumb+ThumbAdenosine diphosphate+Thumb+Thumb+Cobinamide+Thumb
Cobinamide + Adenosine triphosphate + Water + Cobinamide → Adenosine diphosphate + Phosphate + Hydrogen ion + Cobinamide + ADP
ReactionCard
Cyanocobalamin+Thumb+Thumb+ThumbAdenosine diphosphate+Thumb+Thumb+Cyanocobalamin+Thumb
Cyanocobalamin + Adenosine triphosphate + Water + Cyanocobalamin → Adenosine diphosphate + Phosphate + Hydrogen ion + Cyanocobalamin + ADP
ReactionCard
Metabolites:
ECMDB IDNameView
ECMDB00538Adenosine triphosphateMetaboCard
ECMDB01341ADPMetaboCard
ECMDB06902CobinamideMetaboCard
ECMDB21386CyanocobalaminMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB01429PhosphateMetaboCard
ECMDB00494WaterMetaboCard
GO Classification:
Component
cell part
membrane
Function
transporter activity
Process
establishment of localization
transport
Gene Properties
Blattner:Not Available
Gene OrientationNot Available
Centisome Percentage:Not Available
Left Sequence EndNot Available
Right Sequence EndNot Available
Gene Sequence:
>981 bp
ATGCTGACACTTGCCCGCCAACAACAGCGACAAAATATTCGCTGGTTATTATGCCTGTCA
GTTTTGATGCTGCTGGCGCTTCTCTTAAGCCTTTGCGCCGGTGAACAATGGATCTCGCCA
GGTGACTGGTTTACTCCTCGTGGCGAACTGTTCGTCTGGCAAATTCGCCTGCCACGTACG
CTGGCTGTATTGCTGGTTGGTGCGGCGCTGGCTATATCCGGCGCTGTAATGCAGGCGTTG
TTTGAAAATCCTCTGGCAGAACCTGGACTACTTGGCGTCTCTAACGGCGCAGGCGTGGGG
CTTATCGCCGCGGTATTGCTTGGGCAAGGGCAACTCCCCAACTGGGCGCTAGGGCTGTGT
GCGATTGCTGGCGCGCTTATCATCACTTTAATACTCTTACGTTTCGCCCGTCGTCATCTT
TCGACCAGTCGGTTATTGCTGGCTGGCGTTGCATTAGGGATTATCTGTAGCGCACTAATG
ACGTGGGCTATCTACTTTTCCACCTCAGTTGATTTGCGTCAGCTGATGTACTGGATGATG
GGCGGTTTTGGCGGCGTAGACTGGCGGCAAAGCTGGCTGATGCTGGCATTGATCCCCGTG
TTGTTGTGGATCTGTTGTCAGTCCAGGCCGATGAATATGTTAGCACTTGGCGAGATCTCG
GCGCGGCAACTGGGTTTACCCCTGTGGTTCTGGCGCAATGTGCTGGTGGCAGCGACCGGC
TGGATGGTTGGCGTCAGTGTGGCGCTGGCGGGTGCTATCGGCTTTATTGGTCTGGTGATC
CCCCATATTCTCCGGTTGTGTGGTTTAACCGATCATCGCGTATTACTTCCCGGCTGCGCG
CTGGCAGGGGCGAGCGCATTGCTGCTGGCCGATATTGTAGCGCGCCTGGCATTAGCTGCC
GCAGAGCTGCCTATTGGCGTGGTCACCGCAACGTTAGGTGCGCCGGTGTTTATCTGGTTA
TTGTTAAAAGCAGGACGTTAG
Protein Properties
Pfam Domain Function:
Protein Residues:326
Protein Molecular Weight:34949
Protein Theoretical pI:10
PDB File:1L7V
Signaling Regions:
  • None
Transmembrane Regions:
  • 15-35
  • 61-81
  • 88-108
  • 112-132
  • 146-166
  • 184-204
  • 240-260
  • 274-294
  • 302-322
Protein Sequence:
>Vitamin B12 import system permease protein BtuC
MLTLARQQQRQNIRWLLCLSVLMLLALLLSLCAGEQWISPGDWFTPRGELFVWQIRLPRT
LAVLLVGAALAISGAVMQALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPNWALGLC
AIAGALIITLILLRFARRHLSTSRLLLAGVALGIICSALMTWAIYFSTSVDLRQLMYWMM
GGFGGVDWRQSWLMLALIPVLLWICCQSRPMNMLALGEISARQLGLPLWFWRNVLVAATG
WMVGVSVALAGAIGFIGLVIPHILRLCGLTDHRVLLPGCALAGASALLLADIVARLALAA
AELPIGVVTATLGAPVFIWLLLKAGR
References
External Links:
ResourceLink
Uniprot ID:B1XG18
Uniprot Name:BTUC_ECODH
GenBank Gene ID:CP000948
Genebank Protein ID:169889205
PDB ID:1L7V
EchoBASE ID:EB0125
CCDB:BTUC_ECODH
General Reference:
  • Durfee, T., Nelson, R., Baldwin, S., Plunkett, G. 3rd, Burland, V., Mau, B., Petrosino, J. F., Qin, X., Muzny, D. M., Ayele, M., Gibbs, R. A., Csorgo, B., Posfai, G., Weinstock, G. M., Blattner, F. R. (2008). "The complete genome sequence of Escherichia coli DH10B: insights into the biology of a laboratory workhorse." J Bacteriol 190:2597-2606. Pubmed: 18245285