Canmetcon
Identification
Name:Autoinducer 2 import system permease protein lsrD
Synonyms:
  • AI-2 import system permease protein lsrD
Gene Name:lsrD
Enzyme Class:Not Available
Biological Properties
General Function:Involved in transporter activity
Specific Function:Part of the ABC transporter complex lsrABCD involved in autoinducer 2 (AI-2) import. Probably responsible for the translocation of the substrate across the membrane
Cellular Location:Cell inner membrane; Multi-pass membrane protein
SMPDB Pathways:Not Available
KEGG Pathways:Not Available
Transports:
Transport References:
  • Uniprot Consortium (2012). "Reorganizing the protein space at the Universal Protein Resource (UniProt)." Nucleic Acids Res 40:D71-D75. Pubmed: 22102590
Metabolites:
ECMDB IDNameView
ECMDB21368(2R,4S)-2-Methyl-2,3,3,4-tetrahydroxytetrahydrofuranMetaboCard
GO Classification:
Component
cell part
membrane
Function
transporter activity
Process
establishment of localization
transport
Gene Properties
Blattner:Not Available
Gene OrientationNot Available
Centisome Percentage:Not Available
Left Sequence EndNot Available
Right Sequence EndNot Available
Gene Sequence:
>993 bp
ATGCAGAGCGATAAAGTGCTCAATTTGCCGGCAGGCTACTTTGGTATTGTGTTGGGGACG
ATAGGGATGGGATTTGCCTGGCGCTATGCCAGCCAGGTTTGGCAGGTCAGCCACTGGTTA
GGGGATGGGCTGGTGATTCTGGCGATGATCATCTGGGGATTATTGACTAGCGCATTTATT
GCCCGACTCATACGCTTTCCGCATAGCGTGCTGGCGGAAGTTCGCCATCCAGTGCTGAGC
AGTTTTGTGAGTTTGTTTCCGGCAACGACGATGCTGGTGGCGATTGGTTTTGTTCCGTGG
TTTCGCCCACTGGCGGTGTGCCTGTTCAGTTTTGGTGTCGTGGTTCAGTTGGCTTATGCC
GCCTGGCAAACTGCGGGATTATGGCGCGGATCTCACCCTGAAGAAGCTACCACGCCTGGA
CTGTATCTGCCGACAGTTGCCAACAACTTTATCAGCGCAATGGCCTGTGGTGCGTTGGGC
TACACCGACGCCGGTCTGGTGTTTTTAGGCGCAGGCGTTTTCTCATGGCTAAGCCTTGAA
CCGGTGATCTTGCAGCGTCTGCGCAGTTCGGGAGAATTACCCACGGCACTGCGGACATCA
CTCGGCATTCAGCTCGCTCCTGCGCTGGTGGCTTGTAGTGCCTGGCTGAGCGTCAACGGC
GGCGAGGGTGACACGCTGGCGAAAATGCTTTTCGGTTATGGACTGCTGCAACTGCTGTTT
ATGCTACGTCTGATGCCATGGTATCTCTCCCAGCCATTTAATGCTTCATTCTGGAGTTTC
TCGTTCGGCGTATCTGCACTGGCAACCACCGGTTTGCATCTGGGGAGTGGCAGCGATAAT
GGATTTTTCCATACGCTGGCGGTGCCGCTGTTTATCTTTACCAATTTTATTATTGCAATA
CTGCTCATCCGTACTTTTGCGCTTCTGATGCAGGGAAAATTGTTAGTCAGAACCGAGCGC
GCCGTTTTAATGAAAGCAGAGGACAAAGAATGA
Protein Properties
Pfam Domain Function:
Protein Residues:330
Protein Molecular Weight:34456
Protein Theoretical pI:9
Signaling Regions:
  • None
Transmembrane Regions:
  • 5-25
  • 43-63
  • 68-88
  • 89-109
  • 116-136
  • 160-180
  • 210-230
  • 238-258
  • 259-279
  • 286-306
Protein Sequence:
>Autoinducer 2 import system permease protein lsrD
MRIRYGWELALAALLVIEIVAFGAINPRMLDLNMLLFSTSDFICIGIVALPLTMVIVSGG
IDISFGSTIGLCAIALGVLFQSGVPMPLAILLTLLLGALCGLINAGLIIYTKVNPLVITL
GTLYLFAGSALLLSGMAGATGYEGIGGFPMAFTDFANLDVLGLPVPLIIFLICLLVFWLW
LHKTHAGRNVFLIGQSPRVALYSAIPVNRTLCALYAMTGLASAVAAVLLVSYFGSARSDL
GASFLMPAITAVVLGGANIYGGSGSIIGTAIAVLLVGYLQQGLQMAGVPNQVSSALSGAL
LIVVVVGRSVSLHRQQIKEWLARRANNPLP
References
External Links:
ResourceLink
Uniprot ID:B1XEA3
Uniprot Name:LSRD_ECODH
GenBank Gene ID:CP000948
Genebank Protein ID:169888938
EchoBASE ID:EB3569
CCDB:LSRD_ECODH
General Reference:
  • Durfee, T., Nelson, R., Baldwin, S., Plunkett, G. 3rd, Burland, V., Mau, B., Petrosino, J. F., Qin, X., Muzny, D. M., Ayele, M., Gibbs, R. A., Csorgo, B., Posfai, G., Weinstock, G. M., Blattner, F. R. (2008). "The complete genome sequence of Escherichia coli DH10B: insights into the biology of a laboratory workhorse." J Bacteriol 190:2597-2606. Pubmed: 18245285