Canmetcon
Identification
Name:H(+)/Cl(-) exchange transporter ClcA
Synonyms:Not Available
Gene Name:clcA
Enzyme Class:Not Available
Biological Properties
General Function:Involved in ion channel activity
Specific Function:Proton-coupled chloride transporter. Functions as antiport system and exchanges two chloride ions for 1 proton. Probably acts as an electrical shunt for an outwardly-directed proton pump that is linked to amino acid decarboxylation, as part of the extreme acid resistance (XAR) response
Cellular Location:Cell inner membrane; Multi-pass membrane protein
SMPDB Pathways:Not Available
KEGG Pathways:Not Available
Transports:
Transport References:
  • Uniprot Consortium (2012). "Reorganizing the protein space at the Universal Protein Resource (UniProt)." Nucleic Acids Res 40:D71-D75. Pubmed: 22102590
Metabolites:
ECMDB IDNameView
ECMDB04037ChlorideMetaboCard
ECMDB01362Hydrogen (gas)MetaboCard
GO Classification:
Component
cell part
membrane
Function
anion channel activity
chloride channel activity
ion channel activity
ion transmembrane transporter activity
substrate-specific transmembrane transporter activity
transmembrane transporter activity
transporter activity
voltage-gated chloride channel activity
Process
anion transport
chloride transport
establishment of localization
inorganic anion transport
ion transport
transmembrane transport
transport
Gene Properties
Blattner:Not Available
Gene OrientationNot Available
Centisome Percentage:Not Available
Left Sequence EndNot Available
Right Sequence EndNot Available
Gene Sequence:
>1422 bp
ATGAAAACTGATACTCCCTCTTTAGAAACACCGCAGGCCGCGCGCCTGCGACGCAGACAA
CTGATTCGCCAACTTCTTGAGCGCGATAAAACCCCGTTAGCCATTTTGTTTATGGCGGCA
GTCGTCGGCACGCTTGTTGGGCTGGCAGCGGTTGCTTTTGACAAAGGTGTCGCCTGGTTG
CAGAACCAACGTATGGGGGCGCTGGTACATACTGCTGATAATTATCCGCTTCTGTTAACC
GTCGCTTTTCTCTGTTCGGCGGTGCTGGCGATGTTTGGCTACTTTTTGGTGCGCAAATAC
GCGCCGGAAGCAGGTGGTTCGGGGATCCCGGAAATTGAAGGGGCGCTGGAAGATCAACGT
CCCGTTCGCTGGTGGCGTGTATTGCCGGTGAAGTTCTTTGGCGGGCTGGGGACACTCGGC
GGAGGCATGGTGTTGGGGCGCGAAGGGCCAACCGTGCAGATCGGCGGTAACATTGGCCGT
ATGGTGCTTGATATTTTCCGCCTGAAAGGTGACGAAGCTCGCCATACGCTGCTGGCAACC
GGTGCTGCTGCGGGGCTGGCTGCGGCCTTTAACGCGCCGCTGGCGGGTATTTTGTTTATT
ATCGAAGAGATGCGTCCGCAGTTTCGCTATACGTTAATTTCGATTAAAGCGGTATTTATT
GGTGTCATTATGTCGACCATTATGTACCGGATTTTTAATCATGAAGTTGCGTTGATTGAC
GTCGGTAAACTTTCTGATGCGCCGCTTAATACGCTGTGGCTTTATCTGATCCTCGGTATT
ATTTTTGGCATTTTCGGCCCTATTTTTAATAAATGGGTGCTGGGGATGCAGGATTTGCTG
CACCGTGTGCACGGCGGCAATATTACCAAATGGGTGCTAATGGGCGGTGCGATTGGCGGT
CTGTGTGGATTGCTGGGGTTTGTGGCACCAGCAACGTCGGGCGGCGGTTTTAACCTGATT
CCTATCGCTACCGCGGGGAATTTCAGCATGGGAATGCTGGTGTTTATCTTCGTCGCGCGG
GTCATTACCACCTTACTCTGCTTCTCTTCCGGCGCGCCGGGCGGTATTTTTGCCCCGATG
CTGGCGCTGGGTACTGTGCTGGGAACCGCTTTCGGAATGGTTGCCGTTGAGCTGTTTCCG
CAATATCACCTTGAGGCGGGGACGTTTGCTATTGCCGGAATGGGGGCATTACTGGCGGCA
TCTATTCGCGCGCCGTTAACGGGGATCATTCTGGTTCTGGAGATGACCGATAACTACCAG
CTCATTTTGCCAATGATTATTACCGGTCTTGGCGCAACACTATTAGCGCAATTTACCGGC
GGGAAACCGCTATACTCGGCGATTCTTGCGCGCACGCTGGCAAAACAGGAAGCTGAGCAA
CTGGCGCGAAGCAAGGCCGCATCAGCCAGCGAGAATACTTGA
Protein Properties
Pfam Domain Function:
Protein Residues:473
Protein Molecular Weight:50348
Protein Theoretical pI:10
PDB File:1KPK
Signaling Regions:
  • None
Transmembrane Regions:
  • 33-69
  • 77-100
  • 124-141
  • 148-166
  • 215-232
  • 253-281
  • 288-309
  • 330-349
  • 355-376
  • 422-438
Protein Sequence:
>H(+)/Cl(-) exchange transporter ClcA
MKTDTPSLETPQAARLRRRQLIRQLLERDKTPLAILFMAAVVGTLVGLAAVAFDKGVAWL
QNQRMGALVHTADNYPLLLTVAFLCSAVLAMFGYFLVRKYAPEAGGSGIPEIEGALEDQR
PVRWWRVLPVKFFGGLGTLGGGMVLGREGPTVQIGGNIGRMVLDIFRLKGDEARHTLLAT
GAAAGLAAAFNAPLAGILFIIEEMRPQFRYTLISIKAVFIGVIMSTIMYRIFNHEVALID
VGKLSDAPLNTLWLYLILGIIFGIFGPIFNKWVLGMQDLLHRVHGGNITKWVLMGGAIGG
LCGLLGFVAPATSGGGFNLIPIATAGNFSMGMLVFIFVARVITTLLCFSSGAPGGIFAPM
LALGTVLGTAFGMVAVELFPQYHLEAGTFAIAGMGALLAASIRAPLTGIILVLEMTDNYQ
LILPMIITGLGATLLAQFTGGKPLYSAILARTLAKQEAEQLARSKAASASENT
References
External Links:
ResourceLink
Uniprot ID:B1XD25
Uniprot Name:CLCA_ECODH
GenBank Gene ID:CP000948
Genebank Protein ID:169887627
PDB ID:1KPK
CCDB:CLCA_ECODH
General Reference:
  • Durfee, T., Nelson, R., Baldwin, S., Plunkett, G. 3rd, Burland, V., Mau, B., Petrosino, J. F., Qin, X., Muzny, D. M., Ayele, M., Gibbs, R. A., Csorgo, B., Posfai, G., Weinstock, G. M., Blattner, F. R. (2008). "The complete genome sequence of Escherichia coli DH10B: insights into the biology of a laboratory workhorse." J Bacteriol 190:2597-2606. Pubmed: 18245285