Canmetcon
Identification
Name:Cation/acetate symporter ActP
Synonyms:
  • Acetate permease
  • Acetate transporter ActP
Gene Name:actP
Enzyme Class:Not Available
Biological Properties
General Function:Involved in transporter activity
Specific Function:Transports acetate
Cellular Location:Cell inner membrane; Multi-pass membrane protein
SMPDB Pathways:
KEGG Pathways:Not Available
Transports:
Transport References:
  • Uniprot Consortium (2012). "Reorganizing the protein space at the Universal Protein Resource (UniProt)." Nucleic Acids Res 40:D71-D75. Pubmed: 22102590
Metabolites:
ECMDB IDNameView
ECMDB00042Acetic acidMetaboCard
GO Classification:
Component
cell part
integral to membrane
integral to plasma membrane
intrinsic to membrane
membrane
membrane part
Function
transporter activity
Process
establishment of localization
transmembrane transport
transport
Gene Properties
Blattner:Not Available
Gene OrientationNot Available
Centisome Percentage:Not Available
Left Sequence EndNot Available
Right Sequence EndNot Available
Gene Sequence:
>1650 bp
ATGCTCAATCAGAAAATTCAAAACCCTAATCCAGACGAACTGATGATCGAAGTCGATCTC
TGCTATGAGCTGGACCCGTATGAATTAAAACTGGATGAGATGATCGAGGCAGAACCGGAA
CCCGAGATGATTGAAGGGCTGCCTGCCTCTGATGCGCTGACGCCTGCCGATCGCTATCTC
GAACTGTTCGAGCATGTTCAGTCGGCGAAAATTTTCCCCGACAGTAAAACCTTTCCCGAC
TGCGCACCTAAAATGGACCCGCTGGATATCTTAATCCGCTACCGTAAAGTGCGCCGTCAT
CGTGATTTTGACTTGCGCAAGTTTGTTGAAAACCACTTCTGGCTGCCGGAGGTCTACTCC
AGCGAGTATGTATCGGACCCGCAAAATTCCCTGAAAGAGCATATCGACCAGCTGTGGCCG
GTGCTAACCCGCGAACCACAGGATCACATTCCGTGGTCTTCTCTGCTGGCGCTGCCGCAG
TCATATATTGTCCCGGGCGGCCGTTTTAGCGAAACCTACTATTGGGATTCCTATTTCACC
ATGCTGGGGCTGGCGGAAAGTGGTCGGGAAGATTTGCTGAAATGCATGGCCGATAACTTC
GCCTGGATGATCGAAAACTACGGTCACATCCCCAACGGCAACCGCACCTATTATTTGAGC
CGCTCGCAACCACCGGTTTTTGCGCTGATGGTGGAGTTGTTTGAAGAAGATGGTGTACGC
GGTGCGCGCCGCTATCTCGACCACCTTAAAATGGAATATGCCTTCTGGATGGACGGTGCA
GAATCGTTAATCCCTAATCAGGCCTATCGCCATGTTGTGCGGATGCCGGACGGATCGCTG
CTCAACCGTTACTGGGACGATCGCGACACGCCGCGTGACGAATCCTGGCTTGAGGACGTT
GAAACCGCGAAACATTCTGGTCGCCCGCCCAACGAGGTGTACCGCGATTTACGCGCGGGG
GCGGCCTCCGGTTGGGATTACTCTTCCCGTTGGCTGCGTGATACTGGTCGTCTGGCGAGC
ATTCGTACCACCCAGTTCATCCCCATCGATCTGAATGCCTTCCTGTTTAAACTGGAGAGC
GCCATCGCCAACATCTCGGCGCTGAAAGGCGAGAAAGAGACAGAAGCACTGTTCCGCCAG
AAAGCCAGTGCCCGTCGCGATGCGGTAAACCGTTACCTCTGGGATGATGAAAACGGCATC
TACCGCGATTACGACTGGCGACGCGAACAACTGGCGCTGTTTTCCGCTGCCGCCATTGTG
CCACTCTATGTCGGTATGGCGAACCATGAACAGGCCGATCGTCTGGCAAACGCCGTGCGC
AGTCGGTTACTGACACCTGGCGGGATTCTGGCAAGCGAGTACGAAACCGGTGAACAGTGG
GATAAACCCAACGGCTGGGCACCGTTACAATGGATGGCGATTCAGGGATTTAAAATGTAC
GGCGATGACCTTCTGGGTGATGAAATCGCGCGAAGCTGGCTGAAGACGGTGAATCAGTTC
TATCTGGAACAGCACAAACTGATCGAAAAATACCATATTGCCGATGGTGTTCCCCGCGAA
GGCGGCGGTGGCGAGTATCCGTTGCAGGATGGGTTTGGCTGGACTAACGGTGTGGTACGC
CGTTTAATTGGTTTGTACGGCGAACCATAA
Protein Properties
Pfam Domain Function:
Protein Residues:549
Protein Molecular Weight:59197
Protein Theoretical pI:10
Signaling Regions:
  • None
Transmembrane Regions:
  • 33-53
  • 77-97
  • 103-123
  • 148-168
  • 183-203
  • 206-226
  • 262-282
  • 303-323
  • 355-375
  • 404-424
  • 428-448
  • 464-484
  • 493-513
Protein Sequence:
>Cation/acetate symporter ActP
MKRVLTALAATLPFAANAADAISGAVERQPTNWQAIIMFLIFVVFTLGITYWASKRVRSR
SDYYTAGGNITGFQNGLAIAGDYMSAASFLGISALVFTSGYDGLIYSLGFLVGWPIILFL
IAERLRNLGRYTFADVASYRLKQGPIRILSACGSLVVVALYLIAQMVGAGKLIELLFGLN
YHIAVVLVGVLMMMYVLFGGMLATTWVQIIKAVLLLFGASFMAFMVMKHVGFSFNNLFSE
AMAVHPKGVDIMKPGGLVKDPISALSLGLGLMFGTAGLPHILMRFFTVSDAREARKSVFY
ATGFMGYFYILTFIIGFGAIMLVGANPEYKDAAGHLIGGNNMAAVHLANAVGGNLFLGFI
SAVAFATILAVVAGLTLAGASAVSHDLYANVFKKGATEREELRVSKITVLILGVIAIILG
VLFENQNIAFMVGLAFAIAASCNFPIILLSMYWSKLTTRGAMMGGWLGLITAVVLMILGP
TIWVQILGHEKAIFPYEYPALFSITVAFLGIWFFSATDNSAEGARERELFRAQFIRSQTG
FGVEQGRAH
References
External Links:
ResourceLink
Uniprot ID:B1XCV3
Uniprot Name:ACTP_ECODH
GenBank Gene ID:CP000948
Genebank Protein ID:169890865
CCDB:ACTP_ECODH
General Reference:
  • Durfee, T., Nelson, R., Baldwin, S., Plunkett, G. 3rd, Burland, V., Mau, B., Petrosino, J. F., Qin, X., Muzny, D. M., Ayele, M., Gibbs, R. A., Csorgo, B., Posfai, G., Weinstock, G. M., Blattner, F. R. (2008). "The complete genome sequence of Escherichia coli DH10B: insights into the biology of a laboratory workhorse." J Bacteriol 190:2597-2606. Pubmed: 18245285