Canmetcon
Identification
Name:2-keto-3-deoxygluconate permease
Synonyms:
  • KDG permease
Gene Name:kdgT
Enzyme Class:Not Available
Biological Properties
General Function:Involved in 2-keto-3-deoxygluconate:hydrogen symporter activity
Specific Function:The 2-keto-3-deoxygluconate permease transports the degraded pectin products into the bacterial cell, where they serve as carbon and energy sources. This is a hydrogen coupled transport system
Cellular Location:Cell inner membrane; Multi-pass membrane protein
SMPDB Pathways:Not Available
KEGG Pathways:Not Available
Transports:
Transport References:
  • Uniprot Consortium (2012). "Reorganizing the protein space at the Universal Protein Resource (UniProt)." Nucleic Acids Res 40:D71-D75. Pubmed: 22102590
Metabolites:
ECMDB IDNameView
ECMDB013532-Keto-3-deoxy-D-gluconic acidMetaboCard
GO Classification:
Component
cell part
integral to membrane
intrinsic to membrane
membrane part
Function
2-keto-3-deoxygluconate:hydrogen symporter activity
cation transmembrane transporter activity
cation:sugar symporter activity
ion transmembrane transporter activity
solute:cation symporter activity
substrate-specific transmembrane transporter activity
transmembrane transporter activity
transporter activity
Process
carbohydrate transport
establishment of localization
transport
Gene Properties
Blattner:Not Available
Gene OrientationNot Available
Centisome Percentage:Not Available
Left Sequence EndNot Available
Right Sequence EndNot Available
Gene Sequence:
>984 bp
TTGGCGATGGCATGTTTGTGTCTGGCAAACATATCCTGGGCTACTGTTTGTGCAAATAGT
ACTGGCGTAGCAGAAGATGAACACTATGATCTCTCAAATATCTTTAATAGCACCAATAAC
CAGCCAGGGCAGATTGTTGTTTTACCGGAAAAATCCGGCTGGGTAGGTGTCTCAGCAATT
TGTCCACCCGGTACGCTGGTGAATTATACATACCGTAGTTATGTCACCAACTTTATTGTT
CAGGAAACTATCGATAATTATAAATATATGCAATTACATGATTATCTATTAGGTGCGATG
AGTCTGGTTGATAGTGTGATGGATATTCAGTTCCCCCCGCAAAATTATATTCGGATGGGA
ACAGATCCTAACGTTTCGCAAAACCTTCCATTCGGGGTGATGGATTCTCGTTTAATATTT
CGTTTAAAGGTTATTCGTCCCTTTATTAACATGGTGGAGATCCCCAGACAGGTGATGTTT
ACCGTGTATGTGACATCAACGCCTTACGATCCGTTGGTTACACCTGTTTATACCATTAGT
TTTGGTGGCCGGGTTGAAGTACCGCAAAACTGCGAATTAAATGCCGGGCAGATTGTTGAA
TTTGATTTTGGTGATATCGGCGCATCGTTATTTAGTGCGGCAGGGCCGGGTAATCGACCT
GCTGGTGTCATGCCGCAAACCAAGAGCATTGCGGTCAAATGTACGAATGTTGCTGCGCAG
GCTTATTTAACAATGCGTCTGGAAGCCAGTGCCGTTTCTGGTCAGGCGATGGTGTCGGAC
AATCAGGATTTAGGTTTTATTGTCGCCGATCAGAACGATACGCCGATCACGCCTAACGAT
CTCAATAGCGTTATTCCTTTCCGTCTGGATGCAGCTGCGGCAGCCAATGTCACACTTCGC
GCCTGGCCTATCAGTATTACCGGTCAAAAACCGACCGAAGGGCCGTTTAGCGCGCTGGGG
TATTTACGCGTCGATTATCAATGA
Protein Properties
Pfam Domain Function:
Protein Residues:327
Protein Molecular Weight:33669
Protein Theoretical pI:10
Signaling Regions:
  • None
Transmembrane Regions:
  • 10-30
  • 42-62
  • 73-93
  • 95-115
  • 139-159
  • 163-183
  • 199-219
  • 224-244
  • 254-274
  • 289-309
Protein Sequence:
>2-keto-3-deoxygluconate permease
MQIKRSIEKIPGGMMLVPLFLGALCHTFSPGAGKYFGSFTNGMITGTVPILAVWFFCMGA
SIKLSATGTVLRKSGTLVVTKIAVAWVVAAIASRIIPEHGVEVGFFAGLSTLALVAAMDM
TNGGLYASIMQQYGTKEEAGAFVLMSLESGPLMTMIILGTAGIASFEPHVFVGAVLPFLV
GFALGNLDPELREFFSKAVQTLIPFFAFALGNTIDLTVIAQTGLLGILLGVAVIIVTGIP
LIIADKLIGGGDGTAGIAASSSAGAAVATPVLIAEMVPAFKPMAPAATSLVATAVIVTSI
LVPILTSIWSRKVKARAAKIEILGTVK
References
External Links:
ResourceLink
Uniprot ID:B1XB76
Uniprot Name:KDGT_ECODH
GenBank Gene ID:CP000948
Genebank Protein ID:169887951
CCDB:KDGT_ECODH
General Reference:
  • Durfee, T., Nelson, R., Baldwin, S., Plunkett, G. 3rd, Burland, V., Mau, B., Petrosino, J. F., Qin, X., Muzny, D. M., Ayele, M., Gibbs, R. A., Csorgo, B., Posfai, G., Weinstock, G. M., Blattner, F. R. (2008). "The complete genome sequence of Escherichia coli DH10B: insights into the biology of a laboratory workhorse." J Bacteriol 190:2597-2606. Pubmed: 18245285